SCOPe 2.01: Domain d3unzb_: 3unz B:

Lineage for d3unzb_ (3unz B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188447] (254 PDB entries)

8. Domain d3unzb_: 3unz B: [186354]
   automated match to d1ol5a_
   complexed with 0bz, edo

Details for d3unzb_

PDB Entry: 3unz, 2.8 Å

PDB Description: Aurora A in Complex with RPM1679

PDB Compounds: (B:) Aurora kinase A

SCOPe Domain Sequences for d3unzb_:

Sequence; same for both SEQRES and ATOM records:

>d3unzb_ d.144.1.7 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiqs
hlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanalsy
chskrvihrdikpenlllgsagelkiadfgwsvhapssrrdtlcgtldylppemiegrmh
dekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllkh
npsqrpmlrevlehpwitanssk

Timeline for d3unzb_:

• d3unzb_ is new in SCOPe 2.01-stable
  
• d3unzb_ appears in SCOPe 2.02
  
• d3unzb_ appears in the current release, SCOPe 2.08