SCOPe 2.08: Domain d3undd1: 3und D:1-281

Lineage for d3undd1 (3und D:1-281)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.4: Class I DAHP synthetase [51599] (3 proteins)

6. Protein automated matches [190083] (10 species)
   not a true protein

7. Species Burkholderia pseudomallei [TaxId:320372] [189833] (3 PDB entries)

8. Domain d3undd1: 3und D:1-281 [186350]
   Other proteins in same PDB: d3unda2, d3undb2, d3undc2, d3undd2
   automated match to d1o60a_
   complexed with a5p, edo, kd0, pep

Details for d3undd1

PDB Entry: 3und, 2.1 Å

PDB Description: Substrate-bound crystal structure of 2-dehydro-3-deoxyphosphooctonate aldolase from Burkholderia pseudomallei

PDB Compounds: (D:) 2-dehydro-3-deoxyphosphooctonate aldolase 2

SCOPe Domain Sequences for d3undd1:

Sequence; same for both SEQRES and ATOM records:

>d3undd1 c.1.10.4 (D:1-281) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
mnvaispgvtagnslpfvlfgginvlesldftldvcgeyvavtrklgipfvfkasfdkan
rssihsyrgvgldeglkifaevkarfgvpvitdvheaeqaapvaeiadvlqvpaflarqt
dlvvaiakagkpvnvkkpqfmsptqlkhvvskcgevgndrvmlcergssfgydnlvvdml
gfrqmaettggcpvifdvthslqcrdplgdasggrrrqvldlaragiavgiaglfleahp
dpdrarcdgpsalplhqlegllsqmkaiddlvkrmpaleir

Timeline for d3undd1:

• d3undd1 first appeared in SCOPe 2.01, called d3undd_
  
• d3undd1 appears in SCOPe 2.07