Lineage for d3umna_ (3umn A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 937452Superfamily b.1.16: Lamin A/C globular tail domain [74853] (2 families) (S)
  5. 937466Family b.1.16.0: automated matches [191666] (1 protein)
    not a true family
  6. 937467Protein automated matches [191265] (1 species)
    not a true protein
  7. 937468Species Human (Homo sapiens) [TaxId:9606] [189832] (1 PDB entry)
  8. 937469Domain d3umna_: 3umn A: [186344]
    automated match to d1ivta_

Details for d3umna_

PDB Entry: 3umn (more details), 2 Å

PDB Description: Crystal Structure of Lamin-B1
PDB Compounds: (A:) Lamin-B1

SCOPe Domain Sequences for d3umna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3umna_ b.1.16.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sishsasatgnvcieeidvdgkfirlkntseqdqpmggwemirkigdtsvsykytsryvl
kagqtvtiwaanagvtaspptdliwknqnswgtgedvkvilknsqgeevaqrstvfkt

SCOPe Domain Coordinates for d3umna_:

Click to download the PDB-style file with coordinates for d3umna_.
(The format of our PDB-style files is described here.)

Timeline for d3umna_: