Lineage for d3umka_ (3umk A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1736856Fold a.47: STAT-like [47654] (6 superfamilies)
    4 long helices; bundle, left-handed twist (coiled coil); right-handed superhelix
  4. 1736906Superfamily a.47.4: CAPPD, an extracellular domain of amyloid beta A4 protein [109843] (2 families) (S)
    the first three helices are longer than the fourth one and, taken separately, adopt a Spectrin repeat-like fold (46965)
  5. 1736907Family a.47.4.1: CAPPD, an extracellular domain of amyloid beta A4 protein [109844] (2 proteins)
    automatically mapped to Pfam PF12925
  6. 1736912Protein automated matches [191279] (1 species)
    not a true protein
  7. 1736913Species Human (Homo sapiens) [TaxId:9606] [189884] (3 PDB entries)
  8. 1736916Domain d3umka_: 3umk A: [186339]
    automated match to d1rw6a_
    complexed with act, cd, cu

Details for d3umka_

PDB Entry: 3umk (more details), 2.6 Å

PDB Description: x-ray structure of the e2 domain of the human amyloid precursor protein (app) in complex with copper
PDB Compounds: (A:) amyloid beta a4 protein

SCOPe Domain Sequences for d3umka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3umka_ a.47.4.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
denehahfqkakerleakhrermsqvmreweeaerqaknlpkadkkaviqhfqekvesle
qeaanerqqlvethmarveamlndrrrlalenyitalqavpprprhvfnmlkkyvraeqk
drqhtlkhfehvrmvdpkkaaqirsqvmthlrviyermnqslsllynvpavaeeiqdevd
ellq

SCOPe Domain Coordinates for d3umka_:

Click to download the PDB-style file with coordinates for d3umka_.
(The format of our PDB-style files is described here.)

Timeline for d3umka_: