| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.47: STAT-like [47654] (6 superfamilies) 4 long helices; bundle, left-handed twist (coiled coil); right-handed superhelix |
Superfamily a.47.4: CAPPD, an extracellular domain of amyloid beta A4 protein [109843] (2 families) ![]() the first three helices are longer than the fourth one and, taken separately, adopt a Spectrin repeat-like fold (46965) |
| Family a.47.4.1: CAPPD, an extracellular domain of amyloid beta A4 protein [109844] (2 proteins) automatically mapped to Pfam PF12925 |
| Protein automated matches [191279] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [189884] (4 PDB entries) |
| Domain d3umka_: 3umk A: [186339] automated match to d1rw6a_ complexed with act, cd, cu |
PDB Entry: 3umk (more details), 2.6 Å
SCOPe Domain Sequences for d3umka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3umka_ a.47.4.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
denehahfqkakerleakhrermsqvmreweeaerqaknlpkadkkaviqhfqekvesle
qeaanerqqlvethmarveamlndrrrlalenyitalqavpprprhvfnmlkkyvraeqk
drqhtlkhfehvrmvdpkkaaqirsqvmthlrviyermnqslsllynvpavaeeiqdevd
ellq
Timeline for d3umka_: