Lineage for d3umha_ (3umh A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2714459Fold a.47: STAT-like [47654] (6 superfamilies)
    4 long helices; bundle, left-handed twist (coiled coil); right-handed superhelix
  4. 2714523Superfamily a.47.4: CAPPD, an extracellular domain of amyloid beta A4 protein [109843] (2 families) (S)
    the first three helices are longer than the fourth one and, taken separately, adopt a Spectrin repeat-like fold (46965)
  5. 2714524Family a.47.4.1: CAPPD, an extracellular domain of amyloid beta A4 protein [109844] (2 proteins)
    automatically mapped to Pfam PF12925
  6. 2714530Protein automated matches [191279] (1 species)
    not a true protein
  7. 2714531Species Human (Homo sapiens) [TaxId:9606] [189884] (4 PDB entries)
  8. 2714532Domain d3umha_: 3umh A: [186337]
    automated match to d1rw6a_
    complexed with act, cd

Details for d3umha_

PDB Entry: 3umh (more details), 2 Å

PDB Description: X-ray structure of the E2 domain of the human amyloid precursor protein (APP) in complex with cadmium
PDB Compounds: (A:) amyloid beta a4 protein

SCOPe Domain Sequences for d3umha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3umha_ a.47.4.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hahfqkakerleakhrermsqvmreweeaerqaknlpkadkkaviqhfqekvesleqeaa
nerqqlvethmarveamlndrrrlalenyitalqavpprprhvfnmlkkyvraeqkdrqh
tlkhfehvrmvdpkkaaqirsqvmthlrviyermnqslsllynvpavaeeiqdevdellq

SCOPe Domain Coordinates for d3umha_:

Click to download the PDB-style file with coordinates for d3umha_.
(The format of our PDB-style files is described here.)

Timeline for d3umha_: