![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.47: STAT-like [47654] (6 superfamilies) 4 long helices; bundle, left-handed twist (coiled coil); right-handed superhelix |
![]() | Superfamily a.47.4: CAPPD, an extracellular domain of amyloid beta A4 protein [109843] (2 families) ![]() the first three helices are longer than the fourth one and, taken separately, adopt a Spectrin repeat-like fold (46965) |
![]() | Family a.47.4.1: CAPPD, an extracellular domain of amyloid beta A4 protein [109844] (2 proteins) automatically mapped to Pfam PF12925 |
![]() | Protein automated matches [191279] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189884] (4 PDB entries) |
![]() | Domain d3umha_: 3umh A: [186337] automated match to d1rw6a_ complexed with act, cd |
PDB Entry: 3umh (more details), 2 Å
SCOPe Domain Sequences for d3umha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3umha_ a.47.4.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} hahfqkakerleakhrermsqvmreweeaerqaknlpkadkkaviqhfqekvesleqeaa nerqqlvethmarveamlndrrrlalenyitalqavpprprhvfnmlkkyvraeqkdrqh tlkhfehvrmvdpkkaaqirsqvmthlrviyermnqslsllynvpavaeeiqdevdellq
Timeline for d3umha_: