Lineage for d3ulxa_ (3ulx A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2077790Fold b.143: NAC domain [101940] (1 superfamily)
    core: twisted 7-stranded beta-sheet (half-barrel)
  4. 2077791Superfamily b.143.1: NAC domain [101941] (1 family) (S)
  5. 2077792Family b.143.1.1: NAC domain [101942] (2 protein domains)
    Pfam PF02365, NAM; transcription factor domain
  6. 2077799Protein automated matches [191270] (2 species)
    not a true protein
  7. 2077800Species Oryza sativa [TaxId:39947] [189849] (1 PDB entry)
  8. 2077801Domain d3ulxa_: 3ulx A: [186336]
    automated match to d1ut4a_

Details for d3ulxa_

PDB Entry: 3ulx (more details), 2.6 Å

PDB Description: Crystal structural of the conserved domain of Rice Stress-responsive NAC1
PDB Compounds: (A:) Stress-induced transcription factor NAC1

SCOPe Domain Sequences for d3ulxa_:

Sequence, based on SEQRES records: (download)

>d3ulxa_ b.143.1.1 (A:) automated matches {Oryza sativa [TaxId: 39947]}
aeaelnlppgfrfhptddelvehylcrkaagqrlpvpiiaevdlykfdpwdlperalfga
rewyfftprdrkypngsrpnraagngywkatgadkpvaprgrtlgikkalvfyagkaprg
vktdwimheyrladagraaagakkgslrlddwvlcrlynkkn

Sequence, based on observed residues (ATOM records): (download)

>d3ulxa_ b.143.1.1 (A:) automated matches {Oryza sativa [TaxId: 39947]}
aeaelnlppgfrfhptddelvehylcrkaagqrlpvpiiaevdlykfdpwdlperalfga
rewyfftprdrsrpnraagngywkatgadkpvaprgrtlgikkalvfyagkaprgvktdw
imheyrladagrlddwvlcrlynkkn

SCOPe Domain Coordinates for d3ulxa_:

Click to download the PDB-style file with coordinates for d3ulxa_.
(The format of our PDB-style files is described here.)

Timeline for d3ulxa_: