SCOPe 2.03: Domain d3uk2b_: 3uk2 B:

Lineage for d3uk2b_ (3uk2 B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.0: automated matches [191377] (1 protein)
   not a true family

6. Protein automated matches [190459] (31 species)
   not a true protein

7. Species Burkholderia thailandensis [TaxId:271848] [189811] (2 PDB entries)

8. Domain d3uk2b_: 3uk2 B: [186334]
   automated match to d1ihoa_
   complexed with amp, cl, edo, mlt

Details for d3uk2b_

PDB Entry: 3uk2, 2.25 Å

PDB Description: The structure of Pantothenate synthetase from Burkholderia thailandensis

PDB Compounds: (B:) Pantothenate synthetase

SCOPe Domain Sequences for d3uk2b_:

Sequence; same for both SEQRES and ATOM records:

>d3uk2b_ c.26.1.0 (B:) automated matches {Burkholderia thailandensis [TaxId: 271848]}
smkvissiqelrdqlrgqnrtafvptmgnlheghlslmrlarqhgdpvvasifvnrlqfg
pnedfdkyprtlqedieklqkenvyvlfapterdmypepqeyrvqpphdlgdilegefrp
gfftgvctvvtklmacvqprvavfgkkdyqqlmivrrmcqqlalpveivaaetvrdadgl
alssrnrylseaeraeapelaktlarvrdavldgerdlaaierravahlsargwqpdyvs
irrrenlvapsaaqieagdplvvltaaklgatrlidnlei

Timeline for d3uk2b_:

• d3uk2b_ first appeared in SCOPe 2.01
  
• d3uk2b_ appears in SCOPe 2.02
  
• d3uk2b_ appears in SCOPe 2.04
  
• d3uk2b_ appears in the current release, SCOPe 2.08, called d3uk2b1