SCOPe 2.05: Domain d3uipc_: 3uip C:

Lineage for d3uipc_ (3uip C:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.12: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69099] (1 family)
   automatically mapped to Pfam PF07834

5. Family a.118.12.1: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69100] (2 proteins)

6. Protein automated matches [191269] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189848] (4 PDB entries)

8. Domain d3uipc_: 3uip C: [186332]
   Other proteins in same PDB: d3uipa_, d3uipb_
   automated match to d2grnb1

Details for d3uipc_

PDB Entry: 3uip, 2.29 Å

PDB Description: complex between human rangap1-sumo1, ubc9 and the ir1 domain from ranbp2 containing ir2 motif ii

PDB Compounds: (C:) ran gtpase-activating protein 1

SCOPe Domain Sequences for d3uipc_:

Sequence; same for both SEQRES and ATOM records:

>d3uipc_ a.118.12.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
advstflafpspekllrlgpkssvliaqqtdtsdpekvvsaflkvssvfkdeatvrmavq
davdalmqkafnsssfnsntfltrllvhmgllksedkvkaianlygplmalnhmvqqdyf
pkalaplllafvtkpnsalescsfarhsllqtlykv

Timeline for d3uipc_:

• d3uipc_ first appeared in SCOPe 2.01
  
• d3uipc_ appears in SCOPe 2.04
  
• d3uipc_ appears in SCOPe 2.06
  
• d3uipc_ appears in the current release, SCOPe 2.08