![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Superfamily a.118.12: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69099] (1 family) ![]() automatically mapped to Pfam PF07834 |
![]() | Family a.118.12.1: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69100] (2 proteins) |
![]() | Protein automated matches [191269] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189848] (3 PDB entries) |
![]() | Domain d3uipc_: 3uip C: [186332] Other proteins in same PDB: d3uipa_, d3uipb_ automated match to d2grnb1 |
PDB Entry: 3uip (more details), 2.29 Å
SCOPe Domain Sequences for d3uipc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3uipc_ a.118.12.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} advstflafpspekllrlgpkssvliaqqtdtsdpekvvsaflkvssvfkdeatvrmavq davdalmqkafnsssfnsntfltrllvhmgllksedkvkaianlygplmalnhmvqqdyf pkalaplllafvtkpnsalescsfarhsllqtlykv
Timeline for d3uipc_: