Lineage for d3uipc_ (3uip C:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1278585Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1279729Superfamily a.118.12: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69099] (1 family) (S)
    automatically mapped to Pfam PF07834
  5. 1279730Family a.118.12.1: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69100] (2 proteins)
  6. 1279745Protein automated matches [191269] (1 species)
    not a true protein
  7. 1279746Species Human (Homo sapiens) [TaxId:9606] [189848] (3 PDB entries)
  8. 1279747Domain d3uipc_: 3uip C: [186332]
    Other proteins in same PDB: d3uipa_, d3uipb_
    automated match to d2grnb1

Details for d3uipc_

PDB Entry: 3uip (more details), 2.29 Å

PDB Description: complex between human rangap1-sumo1, ubc9 and the ir1 domain from ranbp2 containing ir2 motif ii
PDB Compounds: (C:) ran gtpase-activating protein 1

SCOPe Domain Sequences for d3uipc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uipc_ a.118.12.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
advstflafpspekllrlgpkssvliaqqtdtsdpekvvsaflkvssvfkdeatvrmavq
davdalmqkafnsssfnsntfltrllvhmgllksedkvkaianlygplmalnhmvqqdyf
pkalaplllafvtkpnsalescsfarhsllqtlykv

SCOPe Domain Coordinates for d3uipc_:

Click to download the PDB-style file with coordinates for d3uipc_.
(The format of our PDB-style files is described here.)

Timeline for d3uipc_: