Class a: All alpha proteins [46456] (290 folds) |
Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.12: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69099] (1 family) automatically mapped to Pfam PF07834 |
Family a.118.12.1: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69100] (2 proteins) |
Protein automated matches [191269] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189848] (4 PDB entries) |
Domain d3uipc_: 3uip C: [186332] Other proteins in same PDB: d3uipa_, d3uipb_ automated match to d2grnb1 |
PDB Entry: 3uip (more details), 2.29 Å
SCOPe Domain Sequences for d3uipc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3uipc_ a.118.12.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} advstflafpspekllrlgpkssvliaqqtdtsdpekvvsaflkvssvfkdeatvrmavq davdalmqkafnsssfnsntfltrllvhmgllksedkvkaianlygplmalnhmvqqdyf pkalaplllafvtkpnsalescsfarhsllqtlykv
Timeline for d3uipc_: