SCOPe 2.04: Domain d3uioc_: 3uio C:

Lineage for d3uioc_ (3uio C:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.12: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69099] (1 family)
   automatically mapped to Pfam PF07834

5. Family a.118.12.1: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69100] (2 proteins)

6. Protein automated matches [191269] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189848] (3 PDB entries)

8. Domain d3uioc_: 3uio C: [186330]
   Other proteins in same PDB: d3uioa_, d3uiob_
   automated match to d2grnb1

Details for d3uioc_

PDB Entry: 3uio, 2.6 Å

PDB Description: complex between human rangap1-sumo2, ubc9 and the ir1 domain from ranbp2 containing ir2 motif ii

PDB Compounds: (C:) ran gtpase-activating protein 1

SCOPe Domain Sequences for d3uioc_:

Sequence; same for both SEQRES and ATOM records:

>d3uioc_ a.118.12.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
advstflafpspekllrlgpkssvliaqqtdtsdpekvvsaflkvssvfkdeatvrmavq
davdalmqkafnsssfnsntfltrllvhmgllksedkvkaianlygplmalnhmvqqdyf
pkalaplllafvtkpnsalescsfarhsllqtlykv

Timeline for d3uioc_:

• d3uioc_ first appeared in SCOPe 2.01
  
• d3uioc_ appears in SCOPe 2.03
  
• d3uioc_ appears in SCOPe 2.05
  
• d3uioc_ appears in the current release, SCOPe 2.08