SCOPe 2.07: Domain d3uinc_: 3uin C:

Lineage for d3uinc_ (3uin C:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.12: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69099] (1 family)
   automatically mapped to Pfam PF07834

5. Family a.118.12.1: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69100] (2 proteins)

6. Protein automated matches [191269] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189848] (4 PDB entries)

8. Domain d3uinc_: 3uin C: [186328]
   Other proteins in same PDB: d3uina_, d3uinb_
   automated match to d2grnb1

Details for d3uinc_

PDB Entry: 3uin, 2.6 Å

PDB Description: complex between human rangap1-sumo2, ubc9 and the ir1 domain from ranbp2

PDB Compounds: (C:) ran gtpase-activating protein 1

SCOPe Domain Sequences for d3uinc_:

Sequence; same for both SEQRES and ATOM records:

>d3uinc_ a.118.12.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
advstflafpspekllrlgpkssvliaqqtdtsdpekvvsaflkvssvfkdeatvrmavq
davdalmqkafnsssfnsntfltrllvhmgllksedkvkaianlygplmalnhmvqqdyf
pkalaplllafvtkpnsalescsfarhsllqtlykv

Timeline for d3uinc_:

• d3uinc_ first appeared in SCOPe 2.01
  
• d3uinc_ appears in SCOPe 2.06
  
• d3uinc_ appears in the current release, SCOPe 2.08