Class a: All alpha proteins [46456] (289 folds) |
Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.12: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69099] (1 family) automatically mapped to Pfam PF07834 |
Family a.118.12.1: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69100] (2 proteins) |
Protein automated matches [191269] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189848] (4 PDB entries) |
Domain d3uinc_: 3uin C: [186328] Other proteins in same PDB: d3uina_, d3uinb_ automated match to d2grnb1 |
PDB Entry: 3uin (more details), 2.6 Å
SCOPe Domain Sequences for d3uinc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3uinc_ a.118.12.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} advstflafpspekllrlgpkssvliaqqtdtsdpekvvsaflkvssvfkdeatvrmavq davdalmqkafnsssfnsntfltrllvhmgllksedkvkaianlygplmalnhmvqqdyf pkalaplllafvtkpnsalescsfarhsllqtlykv
Timeline for d3uinc_: