Lineage for d3uinc_ (3uin C:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 921849Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 922820Superfamily a.118.12: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69099] (1 family) (S)
  5. 922821Family a.118.12.1: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69100] (2 proteins)
  6. 922836Protein automated matches [191269] (1 species)
    not a true protein
  7. 922837Species Human (Homo sapiens) [TaxId:9606] [189848] (3 PDB entries)
  8. 922840Domain d3uinc_: 3uin C: [186328]
    Other proteins in same PDB: d3uina_
    automated match to d2grnb1

Details for d3uinc_

PDB Entry: 3uin (more details), 2.6 Å

PDB Description: complex between human rangap1-sumo2, ubc9 and the ir1 domain from ranbp2
PDB Compounds: (C:) ran gtpase-activating protein 1

SCOPe Domain Sequences for d3uinc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uinc_ a.118.12.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
advstflafpspekllrlgpkssvliaqqtdtsdpekvvsaflkvssvfkdeatvrmavq
davdalmqkafnsssfnsntfltrllvhmgllksedkvkaianlygplmalnhmvqqdyf
pkalaplllafvtkpnsalescsfarhsllqtlykv

SCOPe Domain Coordinates for d3uinc_:

Click to download the PDB-style file with coordinates for d3uinc_.
(The format of our PDB-style files is described here.)

Timeline for d3uinc_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3uina_