Class a: All alpha proteins [46456] (218 folds) |
Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily) multihelical; consists of two all-alpha domains |
Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families) |
Family a.93.1.1: CCP-like [48114] (4 proteins) |
Protein Cytochrome c peroxidase, CCP [48119] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (85 PDB entries) |
Domain d1bek__: 1bek - [18632] |
PDB Entry: 1bek (more details), 2.2 Å
SCOP Domain Sequences for d1bek__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bek__ a.93.1.1 (-) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae)} lvhvasvekgrsyedfqkvynaialklreddeydnaigygpvlvrlawhisgtwdkhdnt ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk ipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthlk nsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpk ylsivkeyandqdkffkdfskafeklledgitfpkdapspfifktleeqgl
Timeline for d1bek__: