SCOPe 2.03: Domain d3uiea_: 3uie A:

Lineage for d3uiea_ (3uie A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (58 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [189883] (3 PDB entries)

8. Domain d3uiea_: 3uie A: [186318]
   automated match to d1m7gc_
   complexed with adx, anp, mg

Details for d3uiea_

PDB Entry: 3uie, 1.79 Å

PDB Description: crystal structure of adenosine 5'-phosphosulfate kinase from arabidopsis thaliana in complex with amppnp and aps

PDB Compounds: (A:) Adenylyl-sulfate kinase 1, chloroplastic

SCOPe Domain Sequences for d3uiea_:

Sequence; same for both SEQRES and ATOM records:

>d3uiea_ c.37.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
csvekvdrqrlldqkgcviwvtglsgsgkstlacalnqmlyqkgklcyildgdnvrhgln
rdlsfkaedraenirrvgevaklfadagiiciaslispyrtdrdacrsllpegdfvevfm
dvplsvceardpkglyklaragkikgftgiddpyepplnceislgreggtspiemaekvv
gyldnkgylqa

Timeline for d3uiea_:

• d3uiea_ first appeared in SCOPe 2.01
  
• d3uiea_ appears in SCOPe 2.02
  
• d3uiea_ appears in SCOPe 2.04
  
• d3uiea_ appears in the current release, SCOPe 2.08