Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (58 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [189883] (3 PDB entries) |
Domain d3uiea_: 3uie A: [186318] automated match to d1m7gc_ complexed with adx, anp, mg |
PDB Entry: 3uie (more details), 1.79 Å
SCOPe Domain Sequences for d3uiea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3uiea_ c.37.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} csvekvdrqrlldqkgcviwvtglsgsgkstlacalnqmlyqkgklcyildgdnvrhgln rdlsfkaedraenirrvgevaklfadagiiciaslispyrtdrdacrsllpegdfvevfm dvplsvceardpkglyklaragkikgftgiddpyepplnceislgreggtspiemaekvv gyldnkgylqa
Timeline for d3uiea_: