Lineage for d3uiea_ (3uie A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2872977Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [189883] (8 PDB entries)
  8. 2872985Domain d3uiea_: 3uie A: [186318]
    automated match to d1m7gc_
    complexed with adx, anp, mg

Details for d3uiea_

PDB Entry: 3uie (more details), 1.79 Å

PDB Description: crystal structure of adenosine 5'-phosphosulfate kinase from arabidopsis thaliana in complex with amppnp and aps
PDB Compounds: (A:) Adenylyl-sulfate kinase 1, chloroplastic

SCOPe Domain Sequences for d3uiea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uiea_ c.37.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
csvekvdrqrlldqkgcviwvtglsgsgkstlacalnqmlyqkgklcyildgdnvrhgln
rdlsfkaedraenirrvgevaklfadagiiciaslispyrtdrdacrsllpegdfvevfm
dvplsvceardpkglyklaragkikgftgiddpyepplnceislgreggtspiemaekvv
gyldnkgylqa

SCOPe Domain Coordinates for d3uiea_:

Click to download the PDB-style file with coordinates for d3uiea_.
(The format of our PDB-style files is described here.)

Timeline for d3uiea_: