![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
![]() | Superfamily d.129.3: Bet v1-like [55961] (11 families) ![]() contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
![]() | Family d.129.3.0: automated matches [191339] (1 protein) not a true family |
![]() | Protein automated matches [190218] (21 species) not a true protein |
![]() | Species Mycobacterium smegmatis [TaxId:246196] [189822] (1 PDB entry) |
![]() | Domain d3uida1: 3uid A:2-161 [186316] Other proteins in same PDB: d3uida2, d3uidb2 automated match to d1xfsa_ |
PDB Entry: 3uid (more details), 1.57 Å
SCOPe Domain Sequences for d3uida1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3uida1 d.129.3.0 (A:2-161) automated matches {Mycobacterium smegmatis [TaxId: 246196]} pvtdvkhdldtltltitaefaapvtriwqiyadprqlekvwgppshpatvvdhdlrpggr vtyfmtgpdgekyagyweitavdephsfsfldgfadedfnpntdlpvstnvytftehdgg tratyvgtyasaealqqvldmgviegassainqidallta
Timeline for d3uida1: