Lineage for d3ui0a_ (3ui0 A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1715733Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1715807Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1717797Protein automated matches [190359] (40 species)
    not a true protein
  7. 1717805Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [187427] (31 PDB entries)
  8. 1717832Domain d3ui0a_: 3ui0 A: [186312]
    automated match to d1nxfa_
    complexed with hem

Details for d3ui0a_

PDB Entry: 3ui0 (more details), 1.8 Å

PDB Description: hbi (t72g) deoxy
PDB Compounds: (A:) Globin-1

SCOPe Domain Sequences for d3ui0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ui0a_ a.1.1.2 (A:) automated matches {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
svydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgdvsqgm
andklrghsiglmyalqnfidqldnpddlvcvvekfavnhitrkisaaefgkingpikkv
lasknfgdkyanawaklvavvqaal

SCOPe Domain Coordinates for d3ui0a_:

Click to download the PDB-style file with coordinates for d3ui0a_.
(The format of our PDB-style files is described here.)

Timeline for d3ui0a_: