Lineage for d3uhzb_ (3uhz B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1715733Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1715807Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1717797Protein automated matches [190359] (40 species)
    not a true protein
  7. 1717805Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [187427] (31 PDB entries)
  8. 1717841Domain d3uhzb_: 3uhz B: [186311]
    automated match to d1nxfa_
    complexed with hem

Details for d3uhzb_

PDB Entry: 3uhz (more details), 2 Å

PDB Description: hbi (t72a) deoxy
PDB Compounds: (B:) Globin-1

SCOPe Domain Sequences for d3uhzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uhzb_ a.1.1.2 (B:) automated matches {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
svydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgdvsqgm
andklrghsialmyalqnfidqldnpddlvcvvekfavnhitrkisaaefgkingpikkv
lasknfgdkyanawaklvavvqaal

SCOPe Domain Coordinates for d3uhzb_:

Click to download the PDB-style file with coordinates for d3uhzb_.
(The format of our PDB-style files is described here.)

Timeline for d3uhzb_: