SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3uhzb_ (3uhz B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976488Family a.1.1.2: Globins [46463] (27 protein domains)
    Heme-binding protein
  6. 1978505Protein automated matches [190359] (41 species)
    not a true protein
  7. 1978513Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [187427] (32 PDB entries)
  8. 1978549Domain d3uhzb_: 3uhz B: [186311]
    automated match to d1nxfa_
    complexed with hem

Details for d3uhzb_

PDB Entry: 3uhz (more details), 2 Å

PDB Description: HBI (T72A) deoxy
PDB Compounds: (B:) Globin-1

SCOPe Domain Sequences for d3uhzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uhzb_ a.1.1.2 (B:) automated matches {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
svydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgdvsqgm
andklrghsialmyalqnfidqldnpddlvcvvekfavnhitrkisaaefgkingpikkv
lasknfgdkyanawaklvavvqaal

SCOPe Domain Coordinates for d3uhzb_:

Click to download the PDB-style file with coordinates for d3uhzb_.
(The format of our PDB-style files is described here.)

Timeline for d3uhzb_: