SCOP 1.71: Domain d1ccb__: 1ccb -

Lineage for d1ccb__ (1ccb -)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families)

5. Family a.93.1.1: CCP-like [48114] (4 proteins)

6. Protein Cytochrome c peroxidase, CCP [48119] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (85 PDB entries)

8. Domain d1ccb__: 1ccb - [18631]
   complexed with hem; mutant

Details for d1ccb__

PDB Entry: 1ccb, 2.1 Å

PDB Description: the asp-his-fe triad of cytochrome c peroxidase controls the reduction potential, electronic structure, and coupling of the tryptophan free- radical to the heme

SCOP Domain Sequences for d1ccb__:

Sequence; same for both SEQRES and ATOM records:

>d1ccb__ a.93.1.1 (-) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae)}
lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdnt
ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
ipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthlk
nsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlpteysliqdpk
ylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

Timeline for d1ccb__:

• d1ccb__ first appeared (with stable ids) in SCOP 1.55
  
• d1ccb__ appears in SCOP 1.69
  
• d1ccb__ is called d1ccba_ in SCOP 1.73
  
• d1ccb__ appears in the current release, SCOPe 2.08, called d1ccba_