![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein automated matches [190359] (43 species) not a true protein |
![]() | Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [187427] (32 PDB entries) |
![]() | Domain d3uhxa_: 3uhx A: [186306] automated match to d1nxfa_ complexed with hem |
PDB Entry: 3uhx (more details), 1.7 Å
SCOPe Domain Sequences for d3uhxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3uhxa_ a.1.1.2 (A:) automated matches {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]} svydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgdvsqgm andklrghsitlmyalqnfidqldnpddlvcvvekfavahitrkisaaefgkingpikkv lasknfgdkyanawaklvavvqaal
Timeline for d3uhxa_: