Lineage for d3uhva_ (3uhv A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2688401Protein automated matches [190359] (43 species)
    not a true protein
  7. 2688487Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [187427] (32 PDB entries)
  8. 2688518Domain d3uhva_: 3uhv A: [186302]
    automated match to d1nxfa_
    complexed with hem

Details for d3uhva_

PDB Entry: 3uhv (more details), 1.75 Å

PDB Description: hbi (m37v,l73i) deoxy
PDB Compounds: (A:) Globin-1

SCOPe Domain Sequences for d3uhva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uhva_ a.1.1.2 (A:) automated matches {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
svydaaaqltadvkkdlrdswkvigsdkkgngvalvttlfadnqetigyfkrlgdvsqgm
andklrghsitimyalqnfidqldnpddlvcvvekfavnhitrkisaaefgkingpikkv
lasknfgdkyanawaklvavvqaal

SCOPe Domain Coordinates for d3uhva_:

Click to download the PDB-style file with coordinates for d3uhva_.
(The format of our PDB-style files is described here.)

Timeline for d3uhva_: