SCOP 1.73: Domain d1cmua_: 1cmu A:

Lineage for d1cmua_ (1cmu A:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families)

5. Family a.93.1.1: CCP-like [48114] (4 proteins)

6. Protein Cytochrome c peroxidase, CCP [48119] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (112 PDB entries)

8. Domain d1cmua_: 1cmu A: [18630]
   complexed with hem; mutant

Details for d1cmua_

PDB Entry: 1cmu, 2.1 Å

PDB Description: the role of aspartate-235 in the binding of cations to an artificial cavity at the radical site of cytochrome c peroxidase

PDB Compounds: (A:) cytochrome c peroxidase

SCOP Domain Sequences for d1cmua_:

Sequence; same for both SEQRES and ATOM records:

>d1cmua_ a.93.1.1 (A:) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdnt
ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
ipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthlk
nsgyegpggaannvftnefylnllnedwklekndanneqwdsksgymmlptnysliqdpk
ylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

Timeline for d1cmua_:

• d1cmua_ first appeared (with stable ids) in SCOP 1.55, called d1cmu__
  
• d1cmua_ was called d1cmu__ in SCOP 1.71
  
• d1cmua_ appears in SCOP 1.75
  
• d1cmua_ appears in the current release, SCOPe 2.08