Lineage for d1cmu__ (1cmu -)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 445911Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 445912Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families) (S)
  5. 445913Family a.93.1.1: CCP-like [48114] (4 proteins)
  6. 445926Protein Cytochrome c peroxidase, CCP [48119] (1 species)
  7. 445927Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (85 PDB entries)
  8. 445972Domain d1cmu__: 1cmu - [18630]

Details for d1cmu__

PDB Entry: 1cmu (more details), 2.1 Å

PDB Description: the role of aspartate-235 in the binding of cations to an artificial cavity at the radical site of cytochrome c peroxidase

SCOP Domain Sequences for d1cmu__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cmu__ a.93.1.1 (-) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae)}
lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdnt
ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
ipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthlk
nsgyegpggaannvftnefylnllnedwklekndanneqwdsksgymmlptnysliqdpk
ylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

SCOP Domain Coordinates for d1cmu__:

Click to download the PDB-style file with coordinates for d1cmu__.
(The format of our PDB-style files is described here.)

Timeline for d1cmu__: