| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
| Protein automated matches [190359] (44 species) not a true protein |
| Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [187427] (32 PDB entries) |
| Domain d3uhsb_: 3uhs B: [186297] automated match to d1nxfa_ complexed with hem |
PDB Entry: 3uhs (more details), 2.1 Å
SCOPe Domain Sequences for d3uhsb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3uhsb_ a.1.1.2 (B:) automated matches {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
svydaaaqltadvkkdlrdswkvigsdkkgngvammttlfadnqetigyfkrlgdvsqgm
andklrghsitlmyalqnfidqldnpddlvcvvekfavnhitrkisaaefgkingpikkv
lasknfgdkyanawaklvavvqaal
Timeline for d3uhsb_: