Lineage for d3uhna_ (3uhn A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 901762Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 901763Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 901830Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 903555Protein automated matches [190359] (30 species)
    not a true protein
  7. 903559Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [187427] (30 PDB entries)
  8. 903592Domain d3uhna_: 3uhn A: [186290]
    automated match to d1nxfa_
    complexed with hem

Details for d3uhna_

PDB Entry: 3uhn (more details), 2 Å

PDB Description: hbi (f80y) deoxy
PDB Compounds: (A:) Globin-1

SCOPe Domain Sequences for d3uhna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uhna_ a.1.1.2 (A:) automated matches {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
svydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgdvsqgm
andklrghsitlmyalqnyidqldnpddlvcvvekfavnhitrkisaaefgkingpikkv
lasknfgdkyanawaklvavvqaal

SCOPe Domain Coordinates for d3uhna_:

Click to download the PDB-style file with coordinates for d3uhna_.
(The format of our PDB-style files is described here.)

Timeline for d3uhna_: