| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
| Protein automated matches [190359] (30 species) not a true protein |
| Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [187427] (30 PDB entries) |
| Domain d3uhna_: 3uhn A: [186290] automated match to d1nxfa_ complexed with hem |
PDB Entry: 3uhn (more details), 2 Å
SCOPe Domain Sequences for d3uhna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3uhna_ a.1.1.2 (A:) automated matches {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
svydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgdvsqgm
andklrghsitlmyalqnyidqldnpddlvcvvekfavnhitrkisaaefgkingpikkv
lasknfgdkyanawaklvavvqaal
Timeline for d3uhna_: