SCOPe 2.03: Domain d3uhkd_: 3uhk D:

Lineage for d3uhkd_ (3uhk D:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein automated matches [190359] (36 species)
   not a true protein

7. Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [187427] (31 PDB entries)

8. Domain d3uhkd_: 3uhk D: [186289]
   automated match to d1nxfa_
   complexed with hem

Details for d3uhkd_

PDB Entry: 3uhk, 2 Å

PDB Description: hbi (k96r) without ligand bound

PDB Compounds: (D:) Globin-1

SCOPe Domain Sequences for d3uhkd_:

Sequence; same for both SEQRES and ATOM records:

>d3uhkd_ a.1.1.2 (D:) automated matches {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
svydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgdvsqgm
andklrghsitlmyalqnfidqldnpddlvcvverfavnhitrkisaaefgkingpikkv
lasknfgdkyanawaklvavvqaal

Timeline for d3uhkd_:

• d3uhkd_ first appeared in SCOPe 2.01
  
• d3uhkd_ appears in SCOPe 2.02
  
• d3uhkd_ appears in SCOPe 2.04
  
• d3uhkd_ appears in the current release, SCOPe 2.08