Lineage for d3uhkb_ (3uhk B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976495Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1978657Protein automated matches [190359] (42 species)
    not a true protein
  7. 1978679Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [187427] (32 PDB entries)
  8. 1978723Domain d3uhkb_: 3uhk B: [186287]
    automated match to d1nxfa_
    complexed with hem

Details for d3uhkb_

PDB Entry: 3uhk (more details), 2 Å

PDB Description: hbi (k96r) without ligand bound
PDB Compounds: (B:) Globin-1

SCOPe Domain Sequences for d3uhkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uhkb_ a.1.1.2 (B:) automated matches {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
svydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgdvsqgm
andklrghsitlmyalqnfidqldnpddlvcvverfavnhitrkisaaefgkingpikkv
lasknfgdkyanawaklvavvqaal

SCOPe Domain Coordinates for d3uhkb_:

Click to download the PDB-style file with coordinates for d3uhkb_.
(The format of our PDB-style files is described here.)

Timeline for d3uhkb_: