Lineage for d3uhha_ (3uhh A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1473061Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1473062Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1473136Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1475069Protein automated matches [190359] (38 species)
    not a true protein
  7. 1475077Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [187427] (31 PDB entries)
  8. 1475078Domain d3uhha_: 3uhh A: [186280]
    automated match to d1nxfa_
    complexed with cmo, hem

Details for d3uhha_

PDB Entry: 3uhh (more details), 1.5 Å

PDB Description: hbi (m37a) co bound
PDB Compounds: (A:) Globin-1

SCOPe Domain Sequences for d3uhha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uhha_ a.1.1.2 (A:) automated matches {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
svydaaaqltadvkkdlrdswkvigsdkkgngvalattlfadnqetigyfkrlgdvsqgm
andklrghsitlmyalqnfidqldnpddlvcvvekfavnhitrkisaaefgkingpikkv
lasknfgdkyanawaklvavvqaal

SCOPe Domain Coordinates for d3uhha_:

Click to download the PDB-style file with coordinates for d3uhha_.
(The format of our PDB-style files is described here.)

Timeline for d3uhha_: