Lineage for d1cpg__ (1cpg -)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 445911Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 445912Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families) (S)
  5. 445913Family a.93.1.1: CCP-like [48114] (4 proteins)
  6. 445926Protein Cytochrome c peroxidase, CCP [48119] (1 species)
  7. 445927Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (85 PDB entries)
  8. 445975Domain d1cpg__: 1cpg - [18628]

Details for d1cpg__

PDB Entry: 1cpg (more details), 2.2 Å

PDB Description: a cation binding motif stabilizes the compound i radical of cytochrome c peroxidase

SCOP Domain Sequences for d1cpg__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cpg__ a.93.1.1 (-) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae)}
lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdnt
ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
ipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthlk
nsgyegpqgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpk
ylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

SCOP Domain Coordinates for d1cpg__:

Click to download the PDB-style file with coordinates for d1cpg__.
(The format of our PDB-style files is described here.)

Timeline for d1cpg__: