Lineage for d3uhdb_ (3uhd B:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 901762Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 901763Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 901830Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 903555Protein automated matches [190359] (30 species)
    not a true protein
  7. 903559Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [187427] (30 PDB entries)
  8. 903567Domain d3uhdb_: 3uhd B: [186275]
    automated match to d1nxfa_
    complexed with cmo, hem

Details for d3uhdb_

PDB Entry: 3uhd (more details), 1.6 Å

PDB Description: hbi (n100a) co bound
PDB Compounds: (B:) Globin-1

SCOPe Domain Sequences for d3uhdb_:

Sequence, based on SEQRES records: (download)

>d3uhdb_ a.1.1.2 (B:) automated matches {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
svydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgdvsqgm
andklrghsitlmyalqnfidqldnpddlvcvvekfavahitrkisaaefgkingpikkv
lasknfgdkyanawaklvavvqaal

Sequence, based on observed residues (ATOM records): (download)

>d3uhdb_ a.1.1.2 (B:) automated matches {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
svydaaaqltadvkkdlrdswkvgsdkkgngvalmttlfadnqetigyfkrlgdvsqgma
ndklrghsitlmyalqnfidqldnpddlvcvvekfavahitrkisaaefgkingpikkvl
asknfgdkyanawaklvavvqaal

SCOPe Domain Coordinates for d3uhdb_:

Click to download the PDB-style file with coordinates for d3uhdb_.
(The format of our PDB-style files is described here.)

Timeline for d3uhdb_: