Lineage for d3uhbb_ (3uhb B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2688401Protein automated matches [190359] (43 species)
    not a true protein
  7. 2688487Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [187427] (32 PDB entries)
  8. 2688507Domain d3uhbb_: 3uhb B: [186271]
    automated match to d1nxfa_
    complexed with cmo, hem

Details for d3uhbb_

PDB Entry: 3uhb (more details), 1.6 Å

PDB Description: hbi (r104k) co bound
PDB Compounds: (B:) Globin-1

SCOPe Domain Sequences for d3uhbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uhbb_ a.1.1.2 (B:) automated matches {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
svydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgdvsqgm
andklrghsitlmyalqnfidqldnpddlvcvvekfavnhitkkisaaefgkingpikkv
lasknfgdkyanawaklvavvqaal

SCOPe Domain Coordinates for d3uhbb_:

Click to download the PDB-style file with coordinates for d3uhbb_.
(The format of our PDB-style files is described here.)

Timeline for d3uhbb_: