SCOPe 2.05: Domain d3uexa_: 3uex A:

Lineage for d3uexa_ (3uex A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein beta-Lactoglobulin [50827] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50828] (44 PDB entries)
   Uniprot P02754

8. Domain d3uexa_: 3uex A: [186252]
   automated match to d1bsqa_
   complexed with eoh, ste

Details for d3uexa_

PDB Entry: 3uex, 2.1 Å

PDB Description: bovine beta-lactoglobulin complex with stearic acid

PDB Compounds: (A:) beta-lactoglobulin

SCOPe Domain Sequences for d3uexa_:

Sequence, based on SEQRES records:

>d3uexa_ b.60.1.1 (A:) beta-Lactoglobulin {Cow (Bos taurus) [TaxId: 9913]}
livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
wengecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacq
clvrtpevddealekfdkalkalpmhirlsfnptqleeqchi

Sequence, based on observed residues (ATOM records):

>d3uexa_ b.60.1.1 (A:) beta-Lactoglobulin {Cow (Bos taurus) [TaxId: 9913]}
livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
wengecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmenpeqslacqclv
rtpevddealekfdkalkalpmhirlsfnptqleeqchi

Timeline for d3uexa_:

• d3uexa_ first appeared in SCOPe 2.01
  
• d3uexa_ appears in SCOPe 2.04
  
• d3uexa_ appears in SCOPe 2.06
  
• d3uexa_ appears in the current release, SCOPe 2.08