SCOP 1.75: Domain d1aa4a_: 1aa4 A:

Lineage for d1aa4a_ (1aa4 A:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families)

5. Family a.93.1.1: CCP-like [48114] (4 proteins)

6. Protein Cytochrome c peroxidase, CCP [48119] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (123 PDB entries)
   Uniprot P00431

8. Domain d1aa4a_: 1aa4 A: [18625]
   complexed with hem; mutant

Details for d1aa4a_

PDB Entry: 1aa4, 2.1 Å

PDB Description: specificity of ligand binding in a buried polar cavity of cytochrome c peroxidase

PDB Compounds: (A:) cytochrome c peroxidase

SCOP Domain Sequences for d1aa4a_:

Sequence; same for both SEQRES and ATOM records:

>d1aa4a_ a.93.1.1 (A:) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdnt
ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
ipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthlk
nsgyegpggaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpk
ylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

Timeline for d1aa4a_:

• d1aa4a_ first appeared (with stable ids) in SCOP 1.55, called d1aa4__
  
• d1aa4a_ appears in SCOP 1.73
  
• d1aa4a_ appears in SCOPe 2.01
  
• d1aa4a_ appears in the current release, SCOPe 2.08