SCOPe 2.01: Domain d3ueua_: 3ueu A:

Lineage for d3ueua_ (3ueu A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein beta-Lactoglobulin [50827] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50828] (31 PDB entries)
   Uniprot P02754

8. Domain d3ueua_: 3ueu A: [186249]
   automated match to d1bsqa_
   complexed with cl, dao

Details for d3ueua_

PDB Entry: 3ueu, 2.1 Å

PDB Description: Bovine beta-lactoglobulin complex with lauric acid

PDB Compounds: (A:) beta-lactoglobulin

SCOPe Domain Sequences for d3ueua_:

Sequence, based on SEQRES records:

>d3ueua_ b.60.1.1 (A:) beta-Lactoglobulin {Cow (Bos taurus) [TaxId: 9913]}
ivtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqkw
engecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacqc
lvrtpevddealekfdkalkalpmhirlsfnptqleeqchi

Sequence, based on observed residues (ATOM records):

>d3ueua_ b.60.1.1 (A:) beta-Lactoglobulin {Cow (Bos taurus) [TaxId: 9913]}
ivtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqkw
engecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmenslacqclvrtpe
vddealekfdkalkalpmhirlsfnptqleeqchi

Timeline for d3ueua_:

• d3ueua_ is new in SCOPe 2.01-stable
  
• d3ueua_ appears in SCOPe 2.02
  
• d3ueua_ appears in the current release, SCOPe 2.08