Lineage for d3ue2a1 (3ue2 A:443-559)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2195050Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2195631Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 2195632Protein automated matches [190896] (11 species)
    not a true protein
  7. 2195664Species Human (Homo sapiens) [TaxId:9606] [188315] (87 PDB entries)
  8. 2195665Domain d3ue2a1: 3ue2 A:443-559 [186248]
    Other proteins in same PDB: d3ue2a2
    automated match to d2dita1
    complexed with so4

Details for d3ue2a1

PDB Entry: 3ue2 (more details), 1.23 Å

PDB Description: crystal structure of a rna binding domain of poly-u binding splicing factor 60kda (puf60) from homo sapiens at 1.23 a resolution
PDB Compounds: (A:) Poly(U)-binding-splicing factor PUF60

SCOPe Domain Sequences for d3ue2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ue2a1 d.58.7.0 (A:443-559) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sgssarhmvmqkllrkqestvmvlrnmvdpkdidddlegevteecgkfgavnrviiyqek
qgeeedaeiivkifvefsiasethkaiqalngrwfagrkvvaevydqerfdnsdlsa

SCOPe Domain Coordinates for d3ue2a1:

Click to download the PDB-style file with coordinates for d3ue2a1.
(The format of our PDB-style files is described here.)

Timeline for d3ue2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ue2a2