| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) ![]() |
| Family d.58.7.0: automated matches [191529] (1 protein) not a true family |
| Protein automated matches [190896] (2 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188315] (5 PDB entries) |
| Domain d3ue2a_: 3ue2 A: [186248] automated match to d2dita1 complexed with so4 |
PDB Entry: 3ue2 (more details), 1.23 Å
SCOPe Domain Sequences for d3ue2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ue2a_ d.58.7.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsgssarhmvmqkllrkqestvmvlrnmvdpkdidddlegevteecgkfgavnrviiyqe
kqgeeedaeiivkifvefsiasethkaiqalngrwfagrkvvaevydqerfdnsdlsa
Timeline for d3ue2a_: