Lineage for d3ue2a_ (3ue2 A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1203810Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1205320Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1205796Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 1205797Protein automated matches [190896] (2 species)
    not a true protein
  7. 1205801Species Human (Homo sapiens) [TaxId:9606] [188315] (5 PDB entries)
  8. 1205802Domain d3ue2a_: 3ue2 A: [186248]
    automated match to d2dita1
    complexed with so4

Details for d3ue2a_

PDB Entry: 3ue2 (more details), 1.23 Å

PDB Description: crystal structure of a rna binding domain of poly-u binding splicing factor 60kda (puf60) from homo sapiens at 1.23 a resolution
PDB Compounds: (A:) Poly(U)-binding-splicing factor PUF60

SCOPe Domain Sequences for d3ue2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ue2a_ d.58.7.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsgssarhmvmqkllrkqestvmvlrnmvdpkdidddlegevteecgkfgavnrviiyqe
kqgeeedaeiivkifvefsiasethkaiqalngrwfagrkvvaevydqerfdnsdlsa

SCOPe Domain Coordinates for d3ue2a_:

Click to download the PDB-style file with coordinates for d3ue2a_.
(The format of our PDB-style files is described here.)

Timeline for d3ue2a_: