Lineage for d3udug_ (3udu G:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1873551Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 1873552Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 1873553Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
    the active site is between the two identical subunits
  6. 1873662Protein automated matches [190072] (18 species)
    not a true protein
  7. 1873710Species Campylobacter jejuni [TaxId:197] [189804] (2 PDB entries)
  8. 1873717Domain d3udug_: 3udu G: [186245]
    automated match to d1cm7a_
    complexed with cl, edo

Details for d3udug_

PDB Entry: 3udu (more details), 1.85 Å

PDB Description: crystal structure of putative 3-isopropylmalate dehydrogenase from campylobacter jejuni
PDB Compounds: (G:) 3-isopropylmalate dehydrogenase

SCOPe Domain Sequences for d3udug_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3udug_ c.77.1.1 (G:) automated matches {Campylobacter jejuni [TaxId: 197]}
ktykvavlagdgigplvmkealkiltfiaqkynfsfelneakiggasidaygvalsdetl
klceqsdailfgsvggpkwdnlpidqrperasllplrkhfnlfanlrpckiyeslthasp
lkneiiqkgvdilcvreltggiyfgkqdlgkesaydteiytkkeieriariafesarirk
kkvhlidkanvlassilwrevvanvakdyqdinleymyvdnaamqivknpsifdvmlcsn
lfgdilsdelaaingslgllssaslndkgfglyepaggsapdiahlnianpiaqilsaal
mlkysfkeeqaaqdienaislalaqgkmtkdlnaksylntdemgdcileilkendn

SCOPe Domain Coordinates for d3udug_:

Click to download the PDB-style file with coordinates for d3udug_.
(The format of our PDB-style files is described here.)

Timeline for d3udug_: