![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily) consists of two intertwined (sub)domains related by pseudo dyad; duplication 3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest |
![]() | Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) ![]() the constituent families form similar dimers |
![]() | Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins) the active site is between the two identical subunits |
![]() | Protein automated matches [190072] (22 species) not a true protein |
![]() | Species Campylobacter jejuni [TaxId:197] [189804] (2 PDB entries) |
![]() | Domain d3udub_: 3udu B: [186240] automated match to d1cm7a_ complexed with cl, edo |
PDB Entry: 3udu (more details), 1.85 Å
SCOPe Domain Sequences for d3udub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3udub_ c.77.1.1 (B:) automated matches {Campylobacter jejuni [TaxId: 197]} tykvavlagdgigplvmkealkiltfiaqkynfsfelneakiggasidaygvalsdetlk lceqsdailfgsvggpkwdnlpidqrperasllplrkhfnlfanlrpckiyeslthaspl kneiiqkgvdilcvreltggiyfgkqdlgkesaydteiytkkeieriariafesarirkk kvhlidkanvlassilwrevvanvakdyqdinleymyvdnaamqivknpsifdvmlcsnl fgdilsdelaaingslgllssaslndkgfglyepaggsapdiahlnianpiaqilsaalm lkysfkeeqaaqdienaislalaqgkmtkdlnaksylntdemgdcileilkendn
Timeline for d3udub_: