SCOPe 2.08: Domain d7ccpa_: 7ccp A:

Lineage for d7ccpa_ (7ccp A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.1: CCP-like [48114] (5 proteins)

6. Protein Cytochrome c peroxidase, CCP [48119] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (206 PDB entries)
   Uniprot P00431

8. Domain d7ccpa_: 7ccp A: [18624]
   complexed with hem

Details for d7ccpa_

PDB Entry: 7ccp, 2.2 Å

PDB Description: effect of arginine-48 replacement on the reaction between cytochrome c peroxidase and hydrogen peroxide

PDB Compounds: (A:) cytochrome c peroxidase

SCOPe Domain Sequences for d7ccpa_:

Sequence; same for both SEQRES and ATOM records:

>d7ccpa_ a.93.1.1 (A:) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvllawhisgtwdkhdnt
ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
ipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthlk
nsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpk
ylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

Timeline for d7ccpa_:

• d7ccpa_ first appeared (with stable ids) in SCOP 1.55, called d7ccp__
  
• d7ccpa_ appears in SCOPe 2.07