Lineage for d3udua_ (3udu A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2513202Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2513203Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2513204Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
    the active site is between the two identical subunits
  6. 2513401Protein automated matches [190072] (22 species)
    not a true protein
  7. 2513449Species Campylobacter jejuni [TaxId:197] [189804] (2 PDB entries)
  8. 2513450Domain d3udua_: 3udu A: [186239]
    automated match to d1cm7a_
    complexed with cl, edo

Details for d3udua_

PDB Entry: 3udu (more details), 1.85 Å

PDB Description: crystal structure of putative 3-isopropylmalate dehydrogenase from campylobacter jejuni
PDB Compounds: (A:) 3-isopropylmalate dehydrogenase

SCOPe Domain Sequences for d3udua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3udua_ c.77.1.1 (A:) automated matches {Campylobacter jejuni [TaxId: 197]}
ktykvavlagdgigplvmkealkiltfiaqkynfsfelneakiggasidaygvalsdetl
klceqsdailfgsvggpkwdnlpidqrperasllplrkhfnlfanlrpckiyeslthasp
lkneiiqkgvdilcvreltggiyfgkqdlgkesaydteiytkkeieriariafesarirk
kkvhlidkanvlassilwrevvanvakdyqdinleymyvdnaamqivknpsifdvmlcsn
lfgdilsdelaaingslgllssaslndkgfglyepaggsapdiahlnianpiaqilsaal
mlkysfkeeqaaqdienaislalaqgkmtkdlnaksylntdemgdcileilkendn

SCOPe Domain Coordinates for d3udua_:

Click to download the PDB-style file with coordinates for d3udua_.
(The format of our PDB-style files is described here.)

Timeline for d3udua_: