Lineage for d3ud6a_ (3ud6 A:)
- Root: SCOPe 2.01
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) 
Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 proteins) 
Protein automated matches [190053] (7 species)
not a true protein
Species Artificial gene [TaxId:32630] [188991] (4 PDB entries) 
Domain d3ud6a_: 3ud6 A: [186232]
automated match to d1a53a_
complexed with ll8, so4
Details for d3ud6a_
PDB Entry: 3ud6 (more details), 2.09 Å
PDB Description: Structural analyses of covalent enzyme-substrate analogue complexes reveal strengths and limitations of de novo enzyme design
PDB Compounds: (A:) Retro-AldolaseSCOPe Domain Sequences for d3ud6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ud6a_ c.1.2.4 (A:) automated matches {Artificial gene [TaxId: 32630]}
prylkgwledvvqlslrrpsvrasrqrpiislnerilefnkrnitaiiatymrkspwgld
verdpieyakfmeryavglsicteekyangsyetlrkiassvsipilmadfivkesqidd
aynlgadtvplivkiltereleslleyarsygmepiikindendldialrigarfigics
rdwetleinkenqrklismipsnvvkvastgiserneieelrklgvnafsiisslmrnpe
kikelieg
SCOPe Domain Coordinates for d3ud6a_:
Click to download the PDB-style file with coordinates for d3ud6a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3ud6a_:
- d3ud6a_ is new in SCOPe 2.01-stable
- d3ud6a_ appears in SCOPe 2.02
- d3ud6a_ appears in the current release, SCOPe 2.08, called d3ud6a1
View in 3D