SCOP 1.75: Domain d1cpea_: 1cpe A:

Lineage for d1cpea_ (1cpe A:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families)

5. Family a.93.1.1: CCP-like [48114] (4 proteins)

6. Protein Cytochrome c peroxidase, CCP [48119] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (123 PDB entries)
   Uniprot P00431

8. Domain d1cpea_: 1cpe A: [18623]
   complexed with hem, k p; mutant

Details for d1cpea_

PDB Entry: 1cpe, 2.2 Å

PDB Description: a cation binding motif stabilizes the compound i radical of cytochrome c peroxidase

PDB Compounds: (A:) cytochrome c peroxidase

SCOP Domain Sequences for d1cpea_:

Sequence; same for both SEQRES and ATOM records:

>d1cpea_ a.93.1.1 (A:) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdnt
ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
ipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthlk
nsgyegpggaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpk
ylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

Timeline for d1cpea_:

• d1cpea_ first appeared (with stable ids) in SCOP 1.55, called d1cpe__
  
• d1cpea_ appears in SCOP 1.73
  
• d1cpea_ appears in SCOPe 2.01
  
• d1cpea_ appears in the current release, SCOPe 2.08