Lineage for d3ucxa_ (3ucx A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1346342Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1346343Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1349962Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1349963Protein automated matches [190069] (159 species)
    not a true protein
  7. 1350772Species Mycobacterium smegmatis [TaxId:246196] [189539] (4 PDB entries)
  8. 1350777Domain d3ucxa_: 3ucx A: [186228]
    automated match to d2ew8a1
    complexed with 1pe, cl, pg0

Details for d3ucxa_

PDB Entry: 3ucx (more details), 1.85 Å

PDB Description: the structure of a short chain dehydrogenase from mycobacterium smegmatis
PDB Compounds: (A:) Short chain dehydrogenase

SCOPe Domain Sequences for d3ucxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ucxa_ c.2.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
glltdkvvvisgvgpalgttlarrcaeqgadlvlaartverledvakqvtdtgrralsvg
tditddaqvahlvdetmkaygrvdvvinnafrvpsmkpfanttfehmrdaieltvfgalr
liqgftpaleeskgavvnvnsmvvrhsqakygaykmaksallamsqtlatelgekgirvn
svlpgyiwggtlksyfehqagkygtsvediynaaaagsdlkrlptedevasailfmasdl
asgitgqaldvncgeyka

SCOPe Domain Coordinates for d3ucxa_:

Click to download the PDB-style file with coordinates for d3ucxa_.
(The format of our PDB-style files is described here.)

Timeline for d3ucxa_: