Lineage for d3ubqg_ (3ubq G:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2775521Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2775522Protein Hemagglutinin [49824] (22 species)
    includes rudiment esterase domain
  7. 2775631Species Influenza A virus, different strains [TaxId:11320] [49825] (131 PDB entries)
  8. 2775656Domain d3ubqg_: 3ubq G: [186219]
    Other proteins in same PDB: d3ubqb_, d3ubqd_, d3ubqe2, d3ubqf_, d3ubqh_, d3ubqj_, d3ubql_
    automated match to d1ruyh_
    complexed with nag

Details for d3ubqg_

PDB Entry: 3ubq (more details), 2 Å

PDB Description: influenza hemagglutinin from the 2009 pandemic in complex with ligand 3sln
PDB Compounds: (G:) hemagglutinin HA1

SCOPe Domain Sequences for d3ubqg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ubqg_ b.19.1.2 (G:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
ilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpkt
sswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgih
hpstsadqqslyqnadtyvfvcssryskkfkpeiaicpkvrdqegrmnyywtlvepgdki
tfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpiti
gkcpkyvkstklrlatglrnips

SCOPe Domain Coordinates for d3ubqg_:

Click to download the PDB-style file with coordinates for d3ubqg_.
(The format of our PDB-style files is described here.)

Timeline for d3ubqg_: