Class b: All beta proteins [48724] (180 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
Protein Hemagglutinin [49824] (22 species) includes rudiment esterase domain |
Species Influenza A virus, different strains [TaxId:11320] [49825] (131 PDB entries) |
Domain d3ubqg_: 3ubq G: [186219] Other proteins in same PDB: d3ubqb_, d3ubqd_, d3ubqe2, d3ubqf_, d3ubqh_, d3ubqj_, d3ubql_ automated match to d1ruyh_ complexed with nag |
PDB Entry: 3ubq (more details), 2 Å
SCOPe Domain Sequences for d3ubqg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ubqg_ b.19.1.2 (G:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]} dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw ilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpkt sswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgih hpstsadqqslyqnadtyvfvcssryskkfkpeiaicpkvrdqegrmnyywtlvepgdki tfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpiti gkcpkyvkstklrlatglrnips
Timeline for d3ubqg_: