Lineage for d3ubqe_ (3ubq E:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1778087Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1778088Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1778135Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1778136Protein Hemagglutinin [49824] (7 species)
    includes rudiment esterase domain
  7. 1778153Species Influenza A virus, different strains [TaxId:11320] [49825] (105 PDB entries)
  8. 1778172Domain d3ubqe_: 3ubq E: [186218]
    Other proteins in same PDB: d3ubqb_, d3ubqd_, d3ubqf_, d3ubqh_, d3ubqj_, d3ubql_
    automated match to d1ruyh_
    complexed with nag

Details for d3ubqe_

PDB Entry: 3ubq (more details), 2 Å

PDB Description: influenza hemagglutinin from the 2009 pandemic in complex with ligand 3sln
PDB Compounds: (E:) hemagglutinin HA1

SCOPe Domain Sequences for d3ubqe_:

Sequence, based on SEQRES records: (download)

>d3ubqe_ b.19.1.2 (E:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
pgdtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcnia
gwilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifp
ktsswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwg
ihhpstsadqqslyqnadtyvfvcssryskkfkpeiaicpkvrdqegrmnyywtlvepgd
kitfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpi
tigkcpkyvkstklrlatglrnips

Sequence, based on observed residues (ATOM records): (download)

>d3ubqe_ b.19.1.2 (E:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
pgdtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcnia
gwilgnpectasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpktss
wpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgihhp
stsadqqslyqnadtyvfvcssryskkfkpeiaicpkvrdqegrmnyywtlvepgdkitf
eatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpitigk
cpkyvkstklrlatglrnips

SCOPe Domain Coordinates for d3ubqe_:

Click to download the PDB-style file with coordinates for d3ubqe_.
(The format of our PDB-style files is described here.)

Timeline for d3ubqe_: