Lineage for d3ubng_ (3ubn G:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2040266Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2040267Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2040314Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 protein domains)
  6. 2040315Protein Hemagglutinin [49824] (9 species)
    includes rudiment esterase domain
  7. 2040355Species Influenza A virus, different strains [TaxId:11320] [49825] (116 PDB entries)
  8. 2040415Domain d3ubng_: 3ubn G: [186213]
    Other proteins in same PDB: d3ubnb_, d3ubnd_, d3ubnf_, d3ubnh_, d3ubnj_, d3ubnk2, d3ubnl_
    automated match to d1ruyh_
    complexed with nag

Details for d3ubng_

PDB Entry: 3ubn (more details), 2.51 Å

PDB Description: influenza hemagglutinin from the 2009 pandemic in complex with ligand 6sln
PDB Compounds: (G:) hemagglutinin HA1

SCOPe Domain Sequences for d3ubng_:

Sequence, based on SEQRES records: (download)

>d3ubng_ b.19.1.2 (G:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
ilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpkt
sswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgih
hpstsadqqslyqnadtyvfvcssryskkfkpeiaicpkvrdqegrmnyywtlvepgdki
tfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpiti
gkcpkyvkstklrlatglrnips

Sequence, based on observed residues (ATOM records): (download)

>d3ubng_ b.19.1.2 (G:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
ilgnpecestasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpktss
wpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgihhp
stsadqqslyqnadtyvfvcssryskkfkpeiaicpkvrdqegrmnyywtlvepgdkitf
eatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpitigk
cpkyvkstklrlatglrnips

SCOPe Domain Coordinates for d3ubng_:

Click to download the PDB-style file with coordinates for d3ubng_.
(The format of our PDB-style files is described here.)

Timeline for d3ubng_: